PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00011219001
Common NameGSBRNA2T00011219001, LOC106395074
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 249aa    MW: 27142.8 Da    PI: 9.3148
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00011219001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like962.9e-30102155155
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          +prl+Wtp+LH+rFv+av +L G+++A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  GSBRNA2T00011219001 102 RPRLVWTPQLHKRFVDAVGHL-GIKNAVPKTIMQLMSVEGLTRENVASHLQKYRL 155
                          59*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.1999158IPR017930Myb domain
SuperFamilySSF466891.0E-1999159IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.8E-30101160IPR009057Homeodomain-like
TIGRFAMsTIGR015574.9E-24103155IPR006447Myb domain, plants
PfamPF002496.7E-7105154IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 249 aa     Download sequence    Send to blast
MREETPNWLI RCEEELPSPE ELIPISQTLI TPHLALAFQI GSHNNIHSSP KRTAAMYHQK  60
LQPAATPSPT MMNTDFGGDS STDLGSGGGG GGGDEPARTL KRPRLVWTPQ LHKRFVDAVG  120
HLGIKNAVPK TIMQLMSVEG LTRENVASHL QKYRLYLRRM QGGNGNGVSG GHVIVSDSAT  180
DRLFASSPVP AHLLSHEYLM PSPLMNPYLG KHVVTQQNHV VRNLRYEDSE YGNGDGGRKV  240
LKLFPAGN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A2e-20101160463ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013691058.10.0PREDICTED: transcription factor PCL1-like
RefseqXP_013634583.10.0PREDICTED: transcription factor PCL1
SwissprotQ9SNB41e-44PCL1_ARATH; Transcription factor LUX
TrEMBLA0A078IWA70.0A0A078IWA7_BRANA; BnaC04g52240D protein
TrEMBLA0A0D3BP030.0A0A0D3BP03_BRAOL; Uncharacterized protein
STRINGBra004593.1-P1e-149(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM15492791
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40970.11e-107G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]